Job status for: fadas
Accepted
Queued

Submission detail

Job parameters
Scoring mode: Individual
Scoring resolution: Standard
Scoring status
# Model Status
1711202416275034249debf8209a2675fadas model.pdb_renumbered 1 model.pdb Queued
Sequence, secondary structure and solvent accessibility
          1   5    10   15   20   25   30   35   40   45   50   55   60   65   70   75   80   
          |   |    |    |    |    |    |    |    |    |    |    |    |    |    |    |    |    
Sequence: EDYIEAIANVLEKTPSISDVKDIIARELGQVLEFEIDLYVPPDITVTTGERIKKEVNQIIKEIVDRKSTVKVRLFAAQEEL
SS:       CHHHHHHHHHHHCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEECCCCC
SA:       EEBEEEBBEBBEEBEEBEEEEEEEEEEEEEEBBBBBBBBBEEEBEEEEBEEBBEEBEEEBEEEBEEBEEBEBEEEEBEEEE
Job Queue
Job name # of Models Submission date Status
satyamiqd 1 Mar 6, 2025 Queued
test 1 Mar 5, 2025 Queued
0-SWM 1 Jan 18, 2025 Queued
0-ESM 1 Jan 18, 2025 Queued
0-IT 1 Jan 18, 2025 Queued
0-rf2 1 Jan 18, 2025 Queued
0-af3 1 Jan 18, 2025 Queued
research 1 Nov 30, 2024 Queued
fadas 1 Nov 17, 2024 Queued
luz15-wild 1 Nov 7, 2024 Queued
Test_Fayez 1 Oct 24, 2024 Queued
123s 1 Sep 14, 2024 Running
Test 1 Jul 29, 2024 Running
tria 1 Jun 26, 2024 Running
crypto 1 Jun 5, 2024 Finished
Opsin2 1 May 4, 2024 Finished
666Gavin 1 Mar 12, 2024 Finished
test01 1 Mar 11, 2024 Finished
cupinexm 1 Feb 13, 2024 Finished
1A3S 1 Feb 7, 2024 Finished
test 1 Jan 14, 2024 Finished
KKMLMMKMK 1 Dec 16, 2023 Finished
D-T-P 1 Nov 27, 2023 Finished
NEWDTA 1 Nov 2, 2023 Finished
Amidase 1 Oct 25, 2023 Finished
epo12 1 Sep 13, 2023 Finished
EPO123 1 Sep 12, 2023 Finished
Vffgh 1 Sep 11, 2023 Finished
cnn-dupe 1 Sep 7, 2023 Finished
test 1 Aug 17, 2023 Finished
HOMOSPNS 20 Aug 10, 2023 Finished
SRVR 1 Aug 10, 2023 Finished
saureus_AF 1 Jul 30, 2023 Finished
hello 1 Jul 7, 2023 Finished
a0_fuct 1 Jun 25, 2023 Finished
q8_fuct 1 Jun 25, 2023 Finished
NMRP_STD 139 Jun 2, 2023 Finished
NMRP 9 Jun 2, 2023 Finished
RNA_POLY 1 Jun 2, 2023 Finished
YPGA5 19 May 26, 2023 Finished
5sea 1 May 26, 2023 Finished
6sea 19 May 26, 2023 Finished
YPGA5 20 May 26, 2023 Finished
5se3 1 May 26, 2023 Finished
YPGA4 20 May 26, 2023 Finished
1h1c 20 May 26, 2023 Finished
s0a2 20 May 26, 2023 Finished
GOOSE 20 May 23, 2023 Finished
prot 1 Apr 22, 2023 Finished
7ROA_std 10 Mar 25, 2023 Finished
7ROA 10 Mar 25, 2023 Finished
batch 20 Jan 27, 2023 Finished
test 1 Jan 27, 2023 Finished
BaCoV 116 Dec 14, 2022 Finished
prot 1 Dec 14, 2022 Finished
tese 1 Dec 5, 2022 Finished
tese 1 Dec 5, 2022 Finished
fadera 1 Dec 5, 2022 Finished
Retest5 1 Nov 4, 2022 Finished
Retest4 1 Nov 3, 2022 Finished
Retest3 8 Nov 2, 2022 Finished
Retest2 1 Nov 2, 2022 Finished
Retest1 1 Nov 2, 2022 Finished
example 20 Oct 31, 2022 Finished
mtest 20 Oct 29, 2022 Finished
batch 20 Oct 27, 2022 Finished
multi 20 Oct 27, 2022 Finished
seq2 1 Oct 27, 2022 Finished
seq1 1 Oct 27, 2022 Finished
numb 1 Oct 27, 2022 Finished
seql 1 Oct 26, 2022 Finished
pdbl 1 Oct 26, 2022 Finished
etxt 1 Oct 26, 2022 Finished
Test10 1 Oct 16, 2022 Finished
Test9 1 Oct 16, 2022 Finished
Test8 1 Oct 14, 2022 Finished
Test7 9 Oct 14, 2022 Finished
Test6 126 Oct 13, 2022 Finished
Test5 15 Oct 12, 2022 Finished
Test4 1 Oct 12, 2022 Finished
Test3 1 Oct 12, 2022 Finished
Test2 1 Oct 12, 2022 Finished
Test2 1 Oct 12, 2022 Finished
Test1 1 Oct 10, 2022 Finished
SP178 148 Aug 12, 2022 Finished
cytoplasm 1 Aug 12, 2022 Finished
FRAG 1 Aug 11, 2022 Finished
madp 1 Aug 11, 2022 Finished
FLEX 1 Aug 11, 2022 Finished
qasingle 1 Aug 9, 2022 Finished
SCOR 1 Aug 4, 2022 Finished
example 20 Jul 31, 2022 Finished
11
Number of jobs in the queue
3
Number of jobs running
0
Number of completed jobs last week
DeepRefiner: protein structure refinement server
# Country No. of users No. of jobs
1 United States 31 61
2 India 6 6
3 Indonesia 2 4
4 South Korea 2 2
5 China 1 2
6 Israel 1 2
7 Belgium 1 1
8 Puerto Rico 1 1
9 Japan 1 1
10 Saudi Arabia 1 1
11 New Zealand 1 1
12 France 1 1
13 Brazil 1 1
14 South Africa 1 1
15 Pakistan 1 1
16 Spain 1 1
17 United Arab Emirates 1 1
18 Ukraine 1 1
19 Hong Kong 1 1
20 Singapore 1 1
21 Egypt 1 1
Total: 58 92
  • iQDeep paper is published in JMB.
    Mar 23, 2023
  • iQDeep web server is under beta testing.
    Jul 31, 2022
  • This website is free and open to all users and there is no login requirement.